PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc03112.1.g00080.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 552aa    MW: 60788.2 Da    PI: 8.4184
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc03112.1.g00080.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.63.9e-17228281356
                                   --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rqV +WFqNrRa++k
  Zpz_sc03112.1.g00080.1.am.mk 228 KKRRLNVEQVRTLEKNFELRNKLEPERKLQLARALGLQPRQVAIWFQNRRARWK 281
                                   4568999**********************************************9 PP

2HD-ZIP_I/II125.32.8e-40227318192
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   ekkrrl+ eqv++LE++Fe ++kLeperK +lar+Lglqprqva+WFqnrRAR+ktkqlEkdy+aLkr++da++++n++L 
  Zpz_sc03112.1.g00080.1.am.mk 227 EKKRRLNVEQVRTLEKNFELRNKLEPERKLQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDALKRQLDAVQADNDALL 307
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLreelk 92 
                                   +++++L++e++
  Zpz_sc03112.1.g00080.1.am.mk 308 SQNKKLQAEVM 318
                                   *******9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-18210284IPR009057Homeodomain-like
SuperFamilySSF466896.84E-19219285IPR009057Homeodomain-like
PROSITE profilePS5007117.443223283IPR001356Homeobox domain
SMARTSM003891.2E-16226287IPR001356Homeobox domain
PfamPF000461.5E-14228281IPR001356Homeobox domain
CDDcd000862.92E-15228284No hitNo description
PRINTSPR000313.8E-5254263IPR000047Helix-turn-helix motif
PROSITE patternPS000270258281IPR017970Homeobox, conserved site
PRINTSPR000313.8E-5263279IPR000047Helix-turn-helix motif
PfamPF021831.6E-11283319IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 552 aa     Download sequence    Send to blast
MEKESKWKRE REDERVQVEA ARSWENEQGH VRLWPRTNAG AGQARRGAPE VVGPHPRAVY  60
AALPLLQQLR SLVVNERGRG HEGANASHNL ASVIHLRLQR GRVHHTFTPV TYAHLRPMAS  120
NGMASSPSFF PPNFLLQMQQ APPDHEPQEH HQHHHHLPPP PLHPHHNPFL PSSQCPSLQD  180
FRGMAPMLGK RPMYGADVGG GNEVNGCGGG GGANEDELSD DGSQAGEKKR RLNVEQVRTL  240
EKNFELRNKL EPERKLQLAR ALGLQPRQVA IWFQNRRARW KTKQLEKDYD ALKRQLDAVQ  300
ADNDALLSQN KKLQAEVMSR LTLAELGSMW VSVLAAKRLL EAAAIGAAFS PARVVRTDCI  360
LWNLAAAKPG QREAFWKSQQ QNMQRAAAAT APVDGFTMAA LHRSDARHLC ASSQSILELK  420
GGREAGSELI NLNKKTEASC SNRSENSSEI NLDISRTPPS EGAMDPPAHH HPEHASNGGG  480
MIPFYPSSGR IAGVDIDQLL HSSSGPKIEQ QGNGARAGVQ APETASFSNL LCGVDEPPPF  540
WPWADHQPSI DD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1275283RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9664901e-170EU966490.1 Zea mays clone 294849 homeobox-leucine zipper protein HAT7 mRNA, complete cds.
GenBankKJ7285061e-170KJ728506.1 Zea mays clone pUT6811 HB transcription factor (HB102) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465782.11e-113hypothetical protein SORBIDRAFT_01g045740
SwissprotA2XD084e-77HOX21_ORYSI; Homeobox-leucine zipper protein HOX21
TrEMBLM7ZDS31e-116M7ZDS3_TRIUA; Homeobox-leucine zipper protein HOX21
STRINGSb01g045740.11e-113(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22893894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.17e-56HD-ZIP family protein